PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013597484.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 336aa    MW: 37364.5 Da    PI: 7.0714
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013597484.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.32.3e-4271061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp ++p+kf +vhk+FGasnv kll+++  ++reda++sl+yeAear+rdPvyG+vg+i+ lq++ +ql+++l+
  XP_013597484.1   7 PCAACKFLRRKCTQECVFAPYFPPDNPQKFSYVHKVFGASNVAKLLNEIAANQREDAVNSLFYEAEARLRDPVYGCVGLISILQHRHKQLQQDLE 101
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                      +k+e
  XP_013597484.1 102 NAKKE 106
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381551.1E-924330IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089126.4366107IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MASSSSPCAA CKFLRRKCTQ ECVFAPYFPP DNPQKFSYVH KVFGASNVAK LLNEIAANQR  60
EDAVNSLFYE AEARLRDPVY GCVGLISILQ HRHKQLQQDL ENAKKELAAY VGPQDMLPIL  120
QTHHHPQPHF MSIPPQPQRP SSSSSSASVL TQQQQLHHNL FPMMAIPTGQ LYHQQQQNIF  180
EAQQLAAVNA VAREQQQNEL FRAFGAGGGS NTSPHHYHQN QPQVEVLRFD NGFDFVPTGS  240
VTVTGFNQLS SCGTTVTGMS PSLALGGNFV DSPPTNDSYH TDQQLHHHHQ KQQHHEAQLF  300
IPTQSSQPLP LQTQETQTQS NSESGEGRRS IIDSSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013597485.10.0PREDICTED: LOB domain-containing protein 36 isoform X2
RefseqXP_013597484.10.0PREDICTED: LOB domain-containing protein 36 isoform X1
RefseqXP_013597483.10.0PREDICTED: LOB domain-containing protein 36 isoform X1
SwissprotQ9FKZ31e-154LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0D3D8B90.0A0A0D3D8B9_BRAOL; Uncharacterized protein
STRINGBra012112.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-131ASYMMETRIC LEAVES 2-like 1